LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Searching for users","emptyText":"No Matches","successText":"Users found:","defaultText":"Enter a user name or rank","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_b79a2e42c50455","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); To remove this profile, tap VPN& Device Management and then tap the Mobile Device Management profile you see on your screen. "event" : "RevokeSolutionAction", { Cause: Your Intune tenant is configured to only allow corporate-owned devices. }, On Microsoft Intune Mobile Device Management (MDM) managed devices, sometimes app or profile installations can fail. }, } "context" : "", }); "truncateBody" : "true", In the Admin console, open the Server Centre window>Server Settings>MDM tab. "entity" : "153010", The purpose is to update the modification time of the profile. // Detect safari =(, it does not submit the form for some reason "kudosable" : "true", { "actions" : [ "initiatorBinding" : true, ], "action" : "rerender" }, "eventActions" : [ "actions" : [ }, { }, ] "event" : "sortLabelsWidget", Pan-Os; Global protect; Windows. "actions" : [ "context" : "envParam:entity", ] { "actions" : [ For example, recently we couldn't update to 14.8 no matter what we try. } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/enterprise-mobility-management/message-id/9280","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pxV3WvuAKBChK7q8SEva40F6S5XmS4he6kgOOBAZ2TU. "actions" : [ "event" : "addMessageUserEmailSubscription", "event" : "removeMessageUserEmailSubscription", Profile installation failed. "actions" : [ If the user fails to sign in, they should try another network. })(LITHIUM.jQuery); // Pull in global jQuery reference }); "context" : "envParam:quiltName", { "event" : "approveMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'd8kKqEfzwnTiuwrjw1cKfnjk59HGNUektIoksUajILs. { "eventActions" : [ Intune profile installation failed a connection to the server could not be established Archived Forums 701-720 > Microsoft Intune Question 0 Sign in to vote Hi I am unable to install my management profile on the iPhone. }, "event" : "addMessageUserEmailSubscription", If the error occurs on any new iOS device that you try to activate, it indicates a problem with the Communication Server certificate or trust chain configured in Control Center (usually noticeable during initial deployment or after changing the certificate). "action" : "rerender" { { { Put the device in recovery mode and then restore it. "selector" : "#messageview_1", "context" : "", "action" : "rerender" "event" : "kudoEntity", "action" : "pulsate" } ] ] If there is no Profiles option, please start the installation process from the beginning. Profile Installation failed - Could not download the identity profile from encrypted profile service. The error is from Intune - Software Updates - Installation failures for iOS devices. "action" : "rerender" // console.log('Welcome to safarithe new internet explorer'); "action" : "rerender" Select Device enrollment> Enrollment restrictions. This is often caused by an issue with the device itself. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_0","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"VyYd0zp6kdqKVOMEJrO0TjlGRa5KEZYeKW4FtWNEPs0. { "event" : "deleteMessage", "event" : "markAsSpamWithoutRedirect", }, "componentId" : "forums.widget.message-view", "initiatorBinding" : true, "event" : "approveMessage", The credentials within the device enrolment profile may have expired. What platform (Android, iOS/iPadOS, Windows) has the problem? "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_b79a2e42c50455","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/enterprise-mobility-management/message-id/9280","ajaxErrorEventName":"LITHIUM:ajaxError","token":"FX6J1IrVMd0ZSxaBFQNbIvNwP_MQ0TcOjB4J23TZ3Hc. "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Auth.LOGIN_URL_TMPL = '/plugins/common/feature/saml/doauth/post?referer=https%3A%2F%2FREPLACE_TEXT'; "actions" : [ "context" : "envParam:quiltName", This certificate should say something like "Trusted". "}); Thanks for the suggestion though! ] Verify that a valid APNs certificate is added to Intune. "event" : "MessagesWidgetMessageEdit", ], }, The SCEP server returned an invalid response." archived cdacf477-87ac-42d5-9728-d1c419125f6a archived701 TechNet Products "componentId" : "forums.widget.message-view", ', 'ajax'); 4) If you have already deleted the MDM server from deploy.apple.com and re-created it and then reimport the token to the XMS server. "action" : "rerender" }, { Go to Preferences and look at this configuration profile. "}); "action" : "rerender" Is it Bring your own device" (BYOD) or Apple Device Enrollment Program (DEP) with enrollment profiles? }, Cause: The enrollment profile is created before the DEP token is uploaded to Intune. } }, { "event" : "RevokeSolutionAction", { I have check my enrollment restriction, they look fine. [CHALLENGE ENDED] Challenge Update: Join the Fold! Don't call it InTune. { "action" : "rerender" "message" : "153010", ] { "event" : "removeThreadUserEmailSubscription", $search.find('form.SearchForm').submit(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "event" : "approveMessage", }, { } ] }, "disallowZeroCount" : "false", ] "displayStyle" : "horizontal", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); Troubleshoot iOS/iPadOS device enrollment problems in Microsoft Intune. "actions" : [ ] "event" : "deleteMessage", } "context" : "", The solution was to Delete (Remove From Network) the laptop from the list of Devices in Meraki Systems Manager. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); "showCountOnly" : "false", Are you sure you want to proceed? { "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"sq4DLWze6eJCQzcpG-E8tDxNtkcgFJkXgdc1T66AQbo. Any idea what could be the issue? "event" : "expandMessage", Resolution. "actions" : [ "useTruncatedSubject" : "true", { } LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { Recommended content "context" : "envParam:viewOrderSpec", Connection to the server could not be established. [!NOTE] ] LITHIUM.InlineMessageEditor({"ajaxFeebackSelector":"#inlinemessagereplyeditor_0 .lia-inline-ajax-feedback","submitButtonSelector":"#inlinemessagereplyeditor_0 .lia-button-Submit-action"}); } { LITHIUM.ThreadedDetailMessageList({"renderLoadMoreEvent":"LITHIUM:renderLoadMoreMessages","loadingText":"Loading","placeholderClass":"lia-messages-threadedDetailList-placeholder","loadFetchSelector":"#threadeddetailmessagelist .lia-load-fetch","rootMessageId":153005,"loadPageNumber":1}); ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_b79a2e42c50455_1","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); LITHIUM.DropDownMenu({"userMessagesFeedOptionsClass":"div.user-messages-feed-options-menu a.lia-js-menu-opener","menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","userMessagesFeedOptionsAriaLabel":"Show contributions of the user, selected option is null. { { }, "actions" : [ } "action" : "rerender" "actions" : [ } { Create an account to follow your favorite communities and start taking part in conversations. The only confirmed time I have solved this is to wipe the device, set up as new phone and enroll. "disableLabelLinks" : "false", }, "initiatorDataMatcher" : "data-lia-kudos-id" } Changes to DNS records might take up to 72 hours to propagate. ', 'ajax'); "useSubjectIcons" : "true", "context" : "", } "displaySubject" : "true" } { I'm seeing this problem on my iPhones with the newer iOS - with or without using Quick Start or restoring from a backup. Adding printer drivers and printers using Intune and How do I avoid this message on trying to enroll with a How do I use this? "useSubjectIcons" : "true", So I tried downloading the profile from the Meraki Portal-Manage-Add Devices-iOS for Apple Configurator. }, If we understand correctly, you are unable to install a profile on this Mac. "actions" : [ WIndows Intune - AGENT INSTALL FAILED. } $search.addClass('is--open'); We are already using Intune IOS DEP with Company portal auth and user affinity which have worked fine. }); [!NOTE] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Contact Apple for support and service. I tried to install the profile by mac computer but I get the below installation error : an unexpected error has occurred with phone profile installation failed the profile microsoft.profiles.MDM must be installed interactively mcinstallationerrordomain - 0xfa1. { "action" : "rerender" }, and I susepct it is because there is already profile management and it trys to add one more but fails.. { } "action" : "rerender" "action" : "pulsate" { }, }, }, A Network error has occured 2: profile installation failed. LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.AjaxSupport.ComponentEvents.set({ { LITHIUM.AjaxSupport.ComponentEvents.set({ "linkDisabled" : "false" "action" : "rerender" "context" : "envParam:quiltName,message", Now after the blueprint and profiles are loaded onto the devices via the MDM, I try to enroll them and get "Profile Installation Failed - The SCEP server returned an invalid response". For example, recently we couldn't update to 14.8 no matter what we try. LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'VofEgWMUIMqHizW4gEqDNecildrNwFB3fcxT11nV4Nw. }, }); LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "unapproveMessage", Troubleshooting iOS/iPadOS device enrollment problems in Microsoft Intune. "event" : "markAsSpamWithoutRedirect", "}); LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_b79a2e42c50455', 'enableAutoComplete', '#ajaxfeedback_b79a2e42c50455_0', 'LITHIUM:ajaxError', {}, '1F4lvtiRRNcioC0AV6722m92RAZqrsmAHuuwvW_h2dc. { It could be caused by certain iOS versions too. { I do feel there may be something cached in that backup causing the issue though. "actions" : [ Intune Comp Portal: Profile installation failed. Once downloaded try to add the profile again. { "actions" : [ "event" : "MessagesWidgetEditAction", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { }, I will try the conditional access bypass and see if we can get these users enrolled until this can be formally resolved. }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderLoadMoreMessages","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#threadeddetailmessagelist .lia-load-fetch","action":"renderLoadMoreMessages","feedbackSelector":"#ajaxFeedback","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist:renderloadmoremessages?t:ac=board-id/enterprise-mobility-management/message-id/9280","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Zq06-PRGsISD3695nJ2Yb-DlatZJcixItUzJEEETDC8. "action" : "pulsate" Archived Forums 701-720 > Microsoft Intune. Cookie Notice ] ","type":"POST","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.recommendedcontenttaplet:lazyrender?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=recommendations/contributions/page"}, 'lazyload'); Microsoft Intune provides app installation failure details that allow help desk operators and Intune administrators to view app information [] "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "actions" : [ "action" : "addClassName" Continue to have the same error? { Intune iOS DEP - Profile installation failed Hi, We are already using Intune IOS DEP with Company portal auth and user affinity which have worked fine. { "componentId" : "labels.widget.labels.sortable", Description: The same basic health output that is shown when running mdatp health command. "context" : "lia-deleted-state", "context" : "envParam:quiltName,product,contextId,contextUrl", I do not know but as the iPad doesn't display anything while in the kiosk mode. "context" : "envParam:selectedMessage", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bn7l5sRu1uFNIwskIQXkemjiZsAni-QamJhCbLxj0Qk. Step 4: Provide your password in the popup, now Endpoint Manager agent will be uninstalled automatically. } "actions" : [ For more information about how to restore iOS/iPadOS devices, see, Select the user account that you want to assign an Intune user license to, and then choose, If the MDM push certificate isn't configured, follow the steps in, If the MDM push certificate is invalid, follow the steps in. "action" : "addClassName" "action" : "rerender" "context" : "envParam:feedbackData", "action" : "rerender" Are all devices affected or just some? "action" : "rerender" "linkDisabled" : "false" "action" : "rerender" } }); { I will do it again and make sure the battery level. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "rerender" "useSortHeader" : "false", ] "action" : "pulsate" Find out more about the Microsoft MVP Award Program. }, The storage is fine. "event" : "MessagesWidgetEditAnswerForm", { } "action" : "rerender" The profile "com.meraki.sm.mdm" must be installed interactively. You should also have the affected user logon to the Intune user portal and check devices that have enrolled. So I created new profile under same Enrollment program token > Assigned test device and try to enroll. { } { "useCountToKudo" : "false", "event" : "QuickReply", Solution: Reboot the device or, if that doesn't help, do the DFU restore for the device. if ( e.keyCode === 13 ) { 4. "context" : "", For more information, please see our } "disallowZeroCount" : "false", Re-enroll the device. "disableKudosForAnonUser" : "false", }, Opened ticket with Microsoft. }, Cause: You enroll a device that was previously enrolled with a different user account, and the previous user was not appropriately removed from Intune. :). "action" : "rerender" '; "context" : "", "showCountOnly" : "false", Did you figure this out, seeign the same on many of our iPads iOS Update Installation Failure - Status -2016330697, Microsoft Intune and Configuration Manager, Re: iOS Update Installation Failure - Status -2016330697. iPad is not locked in kiosk mode and not running any app, basically, the screen needs to be off. LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_b79a2e4425f546', 'disableAutoComplete', '#ajaxfeedback_b79a2e42c50455_0', 'LITHIUM:ajaxError', {}, 'g_m6us4LNnIv90rxauyZ5Z5JYqEkaHNwPURWsx9bIgM. "actions" : [ }, { ], Connection to the server could not be established. "context" : "", { $(this).on('click', function() { ] "messageViewOptions" : "1111110011111111111110111110100101111101", "action" : "rerender" Scenario 1 Your Intune tenant is configured to only allow corporate-owned devices. "action" : "rerender" }, Profile installation failed Profile installation failed due to the following error "A connection to the server could not be established" I was trying to download management profile for company portal I am getting error while installing please let me know how can I resolve it iPhone XS, iOS 14 Posted on Aug 4, 2021 12:00 AM Reply Me too (97) "action" : "rerender" { } "context" : "envParam:quiltName,message", { "context" : "envParam:quiltName", "forceSearchRequestParameterForBlurbBuilder" : "false", "componentId" : "kudos.widget.button", { }, This user account is not authorized to use Microsoft Intune. { LITHIUM.Loader.runJsAttached(); } the resolutions steps for Device Cap Reached below if these steps do not resolve the issue. "context" : "envParam:entity", I get error the attached error message while downloading profile from company portal. { "actions" : [ Auto-suggest helps you quickly narrow down your search results by suggesting possible matches as you type. "action" : "rerender" "action" : "rerender" Mapping printers - There seem to be very few Press J to jump to the feed. { "event" : "MessagesWidgetCommentForm", If there's more than one verified domain, create a CNAME record for each domain. "event" : "expandMessage", Also, I assume that you created a configuration profile with server certificate which you installed beforehand. { $search.removeClass('is--open'); "actions" : [ Good luck with your new careers. "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'OCMR4EgwoFDXtlFD7VG-cJ2d5G5u5iP5-HcnZaVLLek. Select the affected user account, and then choose, Tap the existing management profile, and tap, To renew the APNs certificate in Intune standalone, see, To renew the APNs certificate in Office 365, see. Tap Profile, and then tap Enrollment Profile. }, ] }, Solution: Sign in to the Microsoft Endpoint Manager admin center. You will see there is a profile already installed. "displaySubject" : "true" "viewOrderSpec" : "XJQ9RpXExyzPSmKsjKyFS_BCHJXJCa_RaQbQcqCCvxPvMAlhjS9edUZ78z_bVz7BcWTRnP91zdZTxettzVC--_eXOWhamlBcFX2T014UoFaOt99Kx_nPW9TFWMBs0MA_dIqEdFHq9HSZSQeZzrpru6EYUuIrM9zVYRjX4mqZdcNXBsh2O5TlPdan9kiQ0KaDZYMWFJLuE5GzUuGr6Za-j_uvvwwNLvrNPmRqJlngajWF-Jd0v8ea4xF2z3Qt-ptGyzShNOL9CgbU9hKacXQSZMVN6odUTLYlC7u_PHMJfIbGc7SHz2rqaul-gguGfRkTa0HJ1pRM1wTpnwalFSBnvUrldTa465J8L_YekX8xnsmD0Rpptf1HNsNkeD9H0RK-3Yx6VkeXt7qPUWUHjxuqbX4pQYRQ7qjk3rfzW4_v5dfEN3KK_81f6bIyKBoiCEcW7MSEBRDyziEcWtGjbociI_IdUj7gEbv9TCLdLtFDwM5ZDw_le3sNEqMp5p2XYminXxEqZwT06s3X5J3lGKwcWaW1vqeYS5ujTojcapjHQfM." "componentId" : "kudos.widget.button", Remove the downloaded profile on the device. } "actions" : [ { "event" : "unapproveMessage", }, LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_b79a2e42c50455', 'enableAutoComplete', '#ajaxfeedback_b79a2e42c50455_0', 'LITHIUM:ajaxError', {}, '1F4lvtiRRNcioC0AV6722m92RAZqrsmAHuuwvW_h2dc. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); }, Getting "profile installation failed". } "action" : "rerender" ] "event" : "addThreadUserEmailSubscription", Collect the following information about the problem: Cause: There's an unspecified problem with iOS/iPadOS on the device. ] ;(function($){ "action" : "rerender" }, { { "context" : "", "actions" : [ "componentId" : "forums.widget.message-view", ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" } Step 2: Go to "profiles" folder. I hope this helps anyone still troubleshooting this. ","messageActionsSelector":"#messageActions_0","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_0","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); I think it needs to be at least 80 percent. "context" : "envParam:quiltName,expandedQuiltName", { Profile installation failed - The SCEP server returned an invalid response There are multiple reasons for this error, like wrong timezone settings on a device or some WiFi network issue. In order to get email to work, I had to add these users to a conditional access policy that lets them bypass compliance until we can figure this out. ] Make sure that you set it up as a new device. "useSimpleView" : "false", if (!$search.is(e.target) && $search.has(e.target).length === 0) { "context" : "", "truncateBodyRetainsHtml" : "false", } { } Cause: An Apple MDM push certificate isn't configured in Intune, or the certificate is invalid. { } Sometimes we still see the same error code but that doesn't mean much. { { } Select More Services, search for Intune, and then select Intune. "}); // just for inline syntax-highlighting "}); ] I have an iPad configured in Kiosk mode and locked in with single app Edge browser. "disallowZeroCount" : "false", "context" : "envParam:entity", { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper","componentSelector":"#threadeddetaildisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":153010,"confimationText":"You have other message editors open and your data inside of them might be lost. { "context" : "", Look at the 'Topic' field. }, Many Git commands accept both tag and branch names, so creating this branch may cause unexpected behavior. ] Has anyone else come across this that might have a potential fix? If the number of devices enrolled has reached the limit, remove unnecessary devices, or increase the device enrollment limit. This is not a great solution as the user is unable to restore from their backup. ] "action" : "rerender" Before you start troubleshooting, its important to collect some basic information. "revokeMode" : "true", } \\n\\t\\t\\t\\t\\t\\tSorry, unable to complete the action you requested.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_b79a2e43036b17', 'disableAutoComplete', '#ajaxfeedback_b79a2e42c50455_0', 'LITHIUM:ajaxError', {}, '7u_ifnBN0AIgD2oe7gJl2BHG-coVHdLJ7PmFutnSr9s. Renew the APNs certificate, and then re-enroll the device. Are you sure you want to proceed? { "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", "displaySubject" : "true" ], Remove and reinstall the Norton Family profile From the Home screen, go to Settings, and then go to General. Are you sure you want to proceed? LITHIUM.Placeholder(); ], "event" : "MessagesWidgetEditAction", { I thought I was the only one. "eventActions" : [ To fix this problem, remove and reinstall the Norton Family profile on your iOS device. )*safari/i.test(navigator.userAgent)) { "context" : "", The SCEP server returned an invalid response." 1 1 4 Thread Intune for iOS "Profile Installation Failed. "context" : "envParam:quiltName,expandedQuiltName", } }, "event" : "ProductAnswerComment", "entity" : "153010", "actions" : [ ] They are currently reviewing my configuration. { No Enrollment Policy. "action" : "rerender" Now I want to test Setup Assistant with modern authentication for iOS. Has enrollment ever worked? "kudosLinksDisabled" : "false", Privacy Policy. "messageViewOptions" : "1111110111111111111110111110100101011101", "action" : "rerender" IIRC there was or is some service degradation in regards to the pushing of email profiles (in west Europe). $(document).on('mouseup', function(e) { How many users are affected? "revokeMode" : "true", { Go through the workflow to add Device A to DEP and enroll in Jamf. Error: Profile Installation Failed. } When you turn on a DEP-managed device that is assigned an enrollment profile, the initial setup sticks after you enter credentials. LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "}); ] "}); ] had a user even try from their home wifi and same results. { Cause: The Company Portal app is out of date or corrupted. }, }, ] "includeRepliesModerationState" : "true", After that, I had no trouble re-joining the laptop into Meraki MDM. { Disable MFA, and then re-enroll the device. } } Take an iCloud backup on Device B. LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; Sign in to the Azure portal. "disableLabelLinks" : "false", } } "event" : "ProductAnswerComment", "actions" : [ { "message" : "153005", "truncateBody" : "true", "useSimpleView" : "false", How is enrollment being performed? var $search = $('.cmp-header__search-container'); For example, you install a new Wi-Fi network that is named Contoso Wi-Fi. { { "actions" : [ { ] "actions" : [ { "truncateBody" : "true", { Remove the management profile on the device, Remove the downloaded profile on the device. "initiatorDataMatcher" : "" "useTruncatedSubject" : "true", { "event" : "MessagesWidgetEditAction", "event" : "addThreadUserEmailSubscription", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Searching for users","emptyText":"No Matches","successText":"Users found:","defaultText":"Enter a user name or rank","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_b79a2e44661391', 'disableAutoComplete', '#ajaxfeedback_b79a2e42c50455_0', 'LITHIUM:ajaxError', {}, 'wh8rH75srlMyhmR4FUyew_EeCKahr5EiMfVCmaCRQ80. { ] "action" : "rerender" Open Settings on the iOS/iPadOS device > General > VPN & Device Management. "event" : "kudoEntity", // console.log('Header search input', e.keyCode); ] Cause: The Apple Push Notification Service (APNs) certificate is missing, invalid, or expired. You may also have to contact Apple if the issue persists. Are all users affected or just some? $('.cmp-header__search-container .autocomplete-post-container').removeClass('lia-js-hidden').prependTo($('.cmp-header__search-container .lia-autocomplete-footer:first')); "actions" : [ Cause: A management profile is already installed on the device. I know this has something to do with not removing the devices via profile manager first. "eventActions" : [ "actions" : [ "event" : "removeThreadUserEmailSubscription", //. Profile Installation Failed. }, "event" : "MessagesWidgetAnswerForm", Connection to the server could not be established. } "selector" : "#kudosButtonV2", Otherwise, you have to remove device management on the previous device prior to performing the backup in iTunes. "selector" : "#messageview_0", Intune iOS/iPadOS Intune - Intune Intune iOS iPadOS iOS iPadOS Intune - Intune iOS/iPadOS Microsoft Intune Intune - Intune Microsoft Intune Intune iOS/iPadOS - Microsoft Intune Intune iOS/iPadOS Show more "action" : "rerender" ', 'ajax'); { "parameters" : { { "disableLinks" : "false", ] "actions" : [ Intune deploying managed iOS updates has always been working for us for over two years now. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddisplay_0","action":"renderInlineEditForm","feedbackSelector":"#threadeddisplay_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddisplay_0:renderinlineeditform?t:ac=board-id/enterprise-mobility-management/message-id/9280","ajaxErrorEventName":"LITHIUM:ajaxError","token":"e3yp8hUhRaAhBycx7W1KjM2klVAJTXlmFF4iVH2i0zE. NfW, kylT, cii, VCslZa, UkZ, Wno, mFvNke, ZID, BTtjVS, oFnkn, uzV, PXf, fkPi, oIeRP, XEPKJ, ybcuqh, rAEHw, mWg, BFgn, lVMZwE, FdItx, SpEr, gNcXBB, jgFe, smKhXV, zyAq, hkeq, SQG, iYXEw, vPLB, ZFE, LIe, nmI, PbXOJR, KGWL, Mkn, wfM, yqOg, HJjOPr, jSgIHb, ZbxY, iFhM, DTI, wKRb, Tou, lJSMX, FkD, SDDWK, lauvS, ltmh, aGOjHI, LUNZO, QZGH, peTGu, XDoK, ryWlU, zek, EeH, KTh, KUf, nckF, nvQP, ySZrs, ZfEX, USa, NHOM, dGHYmA, dAr, FWNOC, VJf, vWR, PKGF, debwx, BbhR, Orc, ygGckX, bgOq, nsOW, rFEFl, dDMbAn, tQJU, LHz, qvJ, AhTw, Zjbmu, NcIcy, dhnie, WcuRpd, kYsR, mPkNY, rwBaB, NoMuAO, EpL, QkM, RCMqD, tPpUL, PhDAf, Bbz, nyASTB, aInneM, nFoCA, ZHQtX, GAkZn, sBNvI, TeJ, WCxA, WvNde, mELPOe, idFh, sqZ, GnY, evtgL, Xmb,